Lineage for d1b65c_ (1b65 C:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36849Fold d.154: L-aminopeptidase D-Ala-esterase/amidase [56265] (1 superfamily)
  4. 36850Superfamily d.154.1: L-aminopeptidase D-Ala-esterase/amidase [56266] (1 family) (S)
  5. 36851Family d.154.1.1: L-aminopeptidase D-Ala-esterase/amidase [56267] (1 protein)
  6. 36852Protein L-aminopeptidase D-Ala-esterase/amidase [56268] (1 species)
  7. 36853Species Ochrobactrum anthropi [TaxId:529] [56269] (1 PDB entry)
  8. 36856Domain d1b65c_: 1b65 C: [42022]

Details for d1b65c_

PDB Entry: 1b65 (more details), 1.82 Å

PDB Description: Structure of l-aminopeptidase d-ala-esterase/amidase from ochrobactrum anthropi, a prototype for the serine aminopeptidases, reveals a new variant among the ntn hydrolase fold

SCOP Domain Sequences for d1b65c_:

Sequence, based on SEQRES records: (download)

>d1b65c_ d.154.1.1 (C:) L-aminopeptidase D-Ala-esterase/amidase {Ochrobactrum anthropi}
kprardlglpftgvtgpynaitdvdgvgvgfqtiieneprpgrkrparsgvtailphmqs
etpvpvyagvhrfngngemtgthwiedggyflgpvvitnthgigmahhatvrwmvdryas
tyqtddflwimpvvaetydgalndingfpvteadvrkaldnvasgpvqegncgggtgmit
ygfkggtgtasrvvefggrsftigalvqanhgqrdwltiagvpvgqhmrdgtpqsqlqer
gsiivvlatdlplmphqlkrlarrasigigrngtpggnnsgdifiafstanqrpmqhrsa
pfldvemvndepldtvylaavdsveeavvnamiaaedmggtpfdrllvqaidherlravl
rqygrla

Sequence, based on observed residues (ATOM records): (download)

>d1b65c_ d.154.1.1 (C:) L-aminopeptidase D-Ala-esterase/amidase {Ochrobactrum anthropi}
kprardlglpftgvtgpynaitdvdgvgvgfqtiieneprpgrkrparsgvtailphmqs
etpvpvyagvhrfngngemtgthwiedggyflgpvvitnthgigmahhatvrwmvdryas
tyqtddflwimpvvaetydgalndingfpvteadvrkaldnvasgpvqegncgggtgmit
ygfkggtgtasrvvefggrsftigalvqanhgqrdwltiagvpvgqhmrdgtpqsqlsii
vvlatdlplmphqlkrlarrasigigrngtpggnnsgdifiafstanqrpmqhrsapfld
vemvndepldtvylaavdsveeavvnamiaaedmggtpfdrllvqaidherlravlrqyg
rla

SCOP Domain Coordinates for d1b65c_:

Click to download the PDB-style file with coordinates for d1b65c_.
(The format of our PDB-style files is described here.)

Timeline for d1b65c_: