Lineage for d5sbua1 (5sbu A:25-173)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.169: C-type lectin-like [56435] (1 superfamily)
unusual foldSuperfamily d.169.1: C-type lectin-like [56436] (9 families) 
Family d.169.1.4: Link domain [56477] (3 proteins) Protein automated matches [190733] (2 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [187906] (31 PDB entries) 
Domain d5sbua1: 5sbu A:25-173 [420204]
Other proteins in same PDB: d5sbua2
automated match to d2jcra_
complexed with 8c2, dms, pge
Details for d5sbua1
PDB Entry: 5sbu (more details), 1.04 Å
PDB Description: cd44 pandda analysis group deposition -- the hyaluronan-binding domain of cd44 in complex with z839988838
PDB Compounds: (A:) CD44 antigenSCOPe Domain Sequences for d5sbua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5sbua1 d.169.1.4 (A:25-173) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qidlnvtcryagvfhvekngrysisrteaadlcqafnstlptmdqmklalskgfetcryg
fiegnvviprihpnaicaanhtgvyilvtsntshydtycfnasappeedctsvtdlpnsf
dgpvtitivnrdgtryskkgeyrthqedi
SCOPe Domain Coordinates for d5sbua1:
Click to download the PDB-style file with coordinates for d5sbua1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5sbua1:
- d5sbua1 is new in SCOPe 2.08-stable
View in 3D
