Lineage for d1b65a_ (1b65 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996529Fold d.154: DmpA/ArgJ-like [56265] (1 superfamily)
    duplication of beta(3)-alpha-beta-alpha motif; 4 layers: alpha/beta/beta/alpha
  4. 2996530Superfamily d.154.1: DmpA/ArgJ-like [56266] (3 families) (S)
    convergent similarity to the Ntn amidohydrolases
  5. 2996531Family d.154.1.1: DmpA-like [56267] (1 protein)
    Pfam PF03576
  6. 2996532Protein L-aminopeptidase D-Ala-esterase/amidase DmpA [56268] (1 species)
  7. 2996533Species Ochrobactrum anthropi [TaxId:529] [56269] (1 PDB entry)
  8. 2996534Domain d1b65a_: 1b65 A: [42020]

Details for d1b65a_

PDB Entry: 1b65 (more details), 1.82 Å

PDB Description: Structure of l-aminopeptidase d-ala-esterase/amidase from ochrobactrum anthropi, a prototype for the serine aminopeptidases, reveals a new variant among the ntn hydrolase fold
PDB Compounds: (A:) protein (aminopeptidase)

SCOPe Domain Sequences for d1b65a_:

Sequence, based on SEQRES records: (download)

>d1b65a_ d.154.1.1 (A:) L-aminopeptidase D-Ala-esterase/amidase DmpA {Ochrobactrum anthropi [TaxId: 529]}
kprardlglpftgvtgpynaitdvdgvgvgfqtiieneprpgrkrparsgvtailphmqs
etpvpvyagvhrfngngemtgthwiedggyflgpvvitnthgigmahhatvrwmvdryas
tyqtddflwimpvvaetydgalndingfpvteadvrkaldnvasgpvqegncgggtgmit
ygfkggtgtasrvvefggrsftigalvqanhgqrdwltiagvpvgqhmrdgtpqsqlqer
gsiivvlatdlplmphqlkrlarrasigigrngtpggnnsgdifiafstanqrpmqhrsa
pfldvemvndepldtvylaavdsveeavvnamiaaedmggtpfdrllvqaidherlravl
rqygrla

Sequence, based on observed residues (ATOM records): (download)

>d1b65a_ d.154.1.1 (A:) L-aminopeptidase D-Ala-esterase/amidase DmpA {Ochrobactrum anthropi [TaxId: 529]}
kprardlglpftgvtgpynaitdvdgvgvgfqtiieneprpgrkrparsgvtailphmqs
etpvpvyagvhrfngngemtgthwiedggyflgpvvitnthgigmahhatvrwmvdryas
tyqtddflwimpvvaetydgalndingfpvteadvrkaldnvasgpvqegncgggtgmit
ygfkggtgtasrvvefggrsftigalvqanhgqrdwltiagvpvgqhmrdgtpqsqlsii
vvlatdlplmphqlkrlarrasigigrngtpggnnsgdifiafstanqrpmqhrsapfld
vemvndepldtvylaavdsveeavvnamiaaedmggtpfdrllvqaidherlravlrqyg
rla

SCOPe Domain Coordinates for d1b65a_:

Click to download the PDB-style file with coordinates for d1b65a_.
(The format of our PDB-style files is described here.)

Timeline for d1b65a_: