Lineage for d7a3ea_ (7a3e A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2782953Protein c-src protein tyrosine kinase [50064] (3 species)
  7. 2782957Species Chicken (Gallus gallus) [TaxId:9031] [50066] (28 PDB entries)
  8. 3083873Domain d7a3ea_: 7a3e A: [420190]
    automated match to d6xvma_
    complexed with peg, pge, so4; mutant

Details for d7a3ea_

PDB Entry: 7a3e (more details), 1.52 Å

PDB Description: intertwined dimer of the c-src sh3 domain mutant t126s
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d7a3ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7a3ea_ b.34.2.1 (A:) c-src protein tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
ttfvalydyesrtetdlsfkkgerlqivnntegdwwlahsltsgqtgyipsnyvaps

SCOPe Domain Coordinates for d7a3ea_:

Click to download the PDB-style file with coordinates for d7a3ea_.
(The format of our PDB-style files is described here.)

Timeline for d7a3ea_:

  • d7a3ea_ is new in SCOPe 2.08-stable