SCOPe 2.08: Domain d6eoya_: 6eoy A:

Lineage for d6eoya_ (6eoy A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
   automatically mapped to Pfam PF00576

6. Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
   sandwich; 8 strands in 2 sheets

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (322 PDB entries)
   Uniprot P02766 31-143

8. Domain d6eoya_: 6eoy A: [420159]
   automated match to d2wqac_
   complexed with bm8

Details for d6eoya_

PDB Entry: 6eoy, 1.38 Å

PDB Description: transthyretin in complex with 4-(1,3-benzothiazol-2-yl)-2- methylaniline

PDB Compounds: (A:) Transthyretin

SCOPe Domain Sequences for d6eoya_:

Sequence; same for both SEQRES and ATOM records:

>d6eoya_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn

Timeline for d6eoya_:

• d6eoya_ is new in SCOPe 2.08-stable