Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.6: Hypoxia-inducible factor HIF ihhibitor (FIH1) [82194] (1 protein) |
Protein Hypoxia-inducible factor HIF ihhibitor (FIH1) [82195] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [82196] (38 PDB entries) |
Domain d7a1ja_: 7a1j A: [420150] automated match to d2xuma_ complexed with qvn, so4, zn |
PDB Entry: 7a1j (more details), 1.9 Å
SCOPe Domain Sequences for d7a1ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7a1ja_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]} epreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtnlvypal kwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhefveklqd iqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnllligmegn vtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpdyerfpn fqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpkrieyplkahq kvaimrniekmlgealgnpqevgpllntmikgryn
Timeline for d7a1ja_: