Lineage for d9gafc_ (9gaf C:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 419895Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 419896Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 420349Family d.153.1.5: (Glycosyl)asparaginase [56261] (1 protein)
  6. 420350Protein Glycosylasparaginase (aspartylglucosaminidase, AGA) [56262] (3 species)
    the precursor chain is cleaved onto 2 fragments by autoproteolysis
  7. 420356Species Flavobacterium meningosepticum [TaxId:238] [56264] (8 PDB entries)
  8. 420366Domain d9gafc_: 9gaf C: [42009]
    Precursor W11F mutant

Details for d9gafc_

PDB Entry: 9gaf (more details), 1.9 Å

PDB Description: precursor of the w11f mutant glycosylasparaginase from flavobacterium meningosepticum

SCOP Domain Sequences for d9gafc_:

Sequence, based on SEQRES records: (download)

>d9gafc_ d.153.1.5 (C:) Glycosylasparaginase (aspartylglucosaminidase, AGA) {Flavobacterium meningosepticum}
ttnkpivlstfnfglhanveawkvlskggkaldavekgvrlveddptersvgyggrpdrd
grvtldacimdenynigsvacmehiknpisvaravmektphvmlvgdgalefalsqgfkk
enlltaesekewkewlktsqykpivnienhdtigmialdaqgnlsgacttsgmaykmhgr
vgdspiigaglfvdneigaatatghgeevirtvgthlvvelmnqgrtpqqackeaveriv
kivnrrgknlkdiqvgfialnkkgeygayciqdgfnfavhdqkgnrletpgfalk

Sequence, based on observed residues (ATOM records): (download)

>d9gafc_ d.153.1.5 (C:) Glycosylasparaginase (aspartylglucosaminidase, AGA) {Flavobacterium meningosepticum}
ttnkpivlstfnfglhanveawkvlskggkaldavekgvrlveddptersvgyggrpdrd
grvtldacimdenynigsvacmehiknpisvaravmektphvmlvgdgalefalsqgfkk
enlltaesekewkewlkykpivnienhdtigmialdaqgnlsgacttsgmaykmhgrvgd
spiigaglfvdneigaatatghgeevirtvgthlvvelmnqgrtpqqackeaverivkiv
nrrgknlkdiqvgfialnkkgeygayciqdgfnfavhdqkgnrletpgfalk

SCOP Domain Coordinates for d9gafc_:

Click to download the PDB-style file with coordinates for d9gafc_.
(The format of our PDB-style files is described here.)

Timeline for d9gafc_: