Lineage for d1apy.2 (1apy C:,D:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 419895Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 419896Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 420349Family d.153.1.5: (Glycosyl)asparaginase [56261] (1 protein)
  6. 420350Protein Glycosylasparaginase (aspartylglucosaminidase, AGA) [56262] (3 species)
    the precursor chain is cleaved onto 2 fragments by autoproteolysis
  7. 420373Species Human (Homo sapiens) [TaxId:9606] [56263] (2 PDB entries)
  8. 420375Domain d1apy.2: 1apy C:,D: [42005]
    complexed with man, nag

Details for d1apy.2

PDB Entry: 1apy (more details), 2 Å

PDB Description: human aspartylglucosaminidase

SCOP Domain Sequences for d1apy.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1apy.2 d.153.1.5 (C:,D:) Glycosylasparaginase (aspartylglucosaminidase, AGA) {Human (Homo sapiens)}
splplvvntwpfknateaawralasggsaldavesgcamcereqcdgsvgfggspdelge
ttldamimdgttmdvgavgdlrriknaigvarkvlehtthtllvgesattfaqsmgfine
dlstsasqalhsdwlarncqpnywrnvipdpskycgpykppXtigmvvihktghiaagts
tngikfkihgrvgdspipgagayaddtagaaaatgngdilmrflpsyqaveymrrgedpt
iacqkvisriqkhfpeffgavicanvtgsygaacnklstftqfsfmvynseknqpteekv
dci

SCOP Domain Coordinates for d1apy.2:

Click to download the PDB-style file with coordinates for d1apy.2.
(The format of our PDB-style files is described here.)

Timeline for d1apy.2: