![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.5: (Glycosyl)asparaginase [56261] (1 protein) |
![]() | Protein Glycosylasparaginase (aspartylglucosaminidase, AGA) [56262] (3 species) the precursor chain is cleaved onto 2 fragments by autoproteolysis |
![]() | Species Human (Homo sapiens) [TaxId:9606] [56263] (2 PDB entries) |
![]() | Domain d1apy.2: 1apy C:,D: [42005] complexed with man, nag |
PDB Entry: 1apy (more details), 2 Å
SCOP Domain Sequences for d1apy.2:
Sequence; same for both SEQRES and ATOM records: (download)
>g1apy.2 d.153.1.5 (C:,D:) Glycosylasparaginase (aspartylglucosaminidase, AGA) {Human (Homo sapiens)} splplvvntwpfknateaawralasggsaldavesgcamcereqcdgsvgfggspdelge ttldamimdgttmdvgavgdlrriknaigvarkvlehtthtllvgesattfaqsmgfine dlstsasqalhsdwlarncqpnywrnvipdpskycgpykppXtigmvvihktghiaagts tngikfkihgrvgdspipgagayaddtagaaaatgngdilmrflpsyqaveymrrgedpt iacqkvisriqkhfpeffgavicanvtgsygaacnklstftqfsfmvynseknqpteekv dci
Timeline for d1apy.2:
![]() Domains from other chains: (mouse over for more information) d1apy.1, d1apy.1, d1apy.1, d1apy.1 |