Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.5: (Glycosyl)asparaginase [56261] (2 proteins) automatically mapped to Pfam PF01112 |
Protein Glycosylasparaginase (aspartylglucosaminidase, AGA) [56262] (5 species) the precursor chain is cleaved onto 2 fragments by autoproteolysis |
Species Human (Homo sapiens) [TaxId:9606] [56263] (2 PDB entries) |
Domain d1apy.1: 1apy A:,B: [42004] complexed with nag |
PDB Entry: 1apy (more details), 2 Å
SCOPe Domain Sequences for d1apy.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1apy.1 d.153.1.5 (A:,B:) Glycosylasparaginase (aspartylglucosaminidase, AGA) {Human (Homo sapiens) [TaxId: 9606]} splplvvntwpfknateaawralasggsaldavesgcamcereqcdgsvgfggspdelge ttldamimdgttmdvgavgdlrriknaigvarkvlehtthtllvgesattfaqsmgfine dlstsasqalhsdwlarncqpnywrnvipdpskycgpykppXtigmvvihktghiaagts tngikfkihgrvgdspipgagayaddtagaaaatgngdilmrflpsyqaveymrrgedpt iacqkvisriqkhfpeffgavicanvtgsygaacnklstftqfsfmvynseknqpteekv dci
Timeline for d1apy.1:
View in 3D Domains from other chains: (mouse over for more information) d1apy.2, d1apy.2, d1apy.2, d1apy.2 |