SCOP 1.59: Domain d1g3ip_: 1g3i P:

Lineage for d1g3ip_ (1g3i P:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.153: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56234] (1 superfamily)

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families)

5. Family d.153.1.4: Proteasome subunits [56251] (3 proteins)

6. Protein HslV (ClpQ) protease [56258] (2 species)

7. Species Haemophilus influenzae [TaxId:727] [56260] (3 PDB entries)

8. Domain d1g3ip_: 1g3i P: [42001]
   Other proteins in same PDB: d1g3ia_, d1g3ib_, d1g3ic_, d1g3id_, d1g3ie_, d1g3if_, d1g3is_, d1g3it_, d1g3iu_, d1g3iv_, d1g3iw_, d1g3ix_

Details for d1g3ip_

PDB Entry: 1g3i, 3.41 Å

PDB Description: crystal structure of the hsluv protease-chaperone complex

SCOP Domain Sequences for d1g3ip_:

Sequence; same for both SEQRES and ATOM records:

>d1g3ip_ d.153.1.4 (P:) HslV (ClpQ) protease {Haemophilus influenzae}
ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp

Timeline for d1g3ip_:

• d1g3ip_ first appeared (with stable ids) in SCOP 1.55
  
• d1g3ip_ appears in SCOP 1.57
  
• d1g3ip_ appears in SCOP 1.61
  
• d1g3ip_ appears in the current release, SCOPe 2.08