Lineage for d1g3ih_ (1g3i H:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 735798Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 735799Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (6 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 735943Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 735944Protein HslV (ClpQ) protease [56258] (3 species)
    dodecameric prokaryotic homologue of proteasome
  7. 735981Species Haemophilus influenzae [TaxId:727] [56260] (6 PDB entries)
  8. 736013Domain d1g3ih_: 1g3i H: [41993]
    Other proteins in same PDB: d1g3ia_, d1g3ib_, d1g3ic_, d1g3id_, d1g3ie_, d1g3if_, d1g3is_, d1g3it_, d1g3iu_, d1g3iv_, d1g3iw_, d1g3ix_

Details for d1g3ih_

PDB Entry: 1g3i (more details), 3.41 Å

PDB Description: crystal structure of the hsluv protease-chaperone complex
PDB Compounds: (H:) ATP-dependent protease hslv

SCOP Domain Sequences for d1g3ih_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g3ih_ d.153.1.4 (H:) HslV (ClpQ) protease {Haemophilus influenzae [TaxId: 727]}
ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp

SCOP Domain Coordinates for d1g3ih_:

Click to download the PDB-style file with coordinates for d1g3ih_.
(The format of our PDB-style files is described here.)

Timeline for d1g3ih_: