Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (6 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (3 proteins) |
Protein HslV (ClpQ) protease [56258] (3 species) dodecameric prokaryotic homologue of proteasome |
Species Haemophilus influenzae [TaxId:727] [56260] (6 PDB entries) |
Domain d1g3ih_: 1g3i H: [41993] Other proteins in same PDB: d1g3ia_, d1g3ib_, d1g3ic_, d1g3id_, d1g3ie_, d1g3if_, d1g3is_, d1g3it_, d1g3iu_, d1g3iv_, d1g3iw_, d1g3ix_ |
PDB Entry: 1g3i (more details), 3.41 Å
SCOP Domain Sequences for d1g3ih_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g3ih_ d.153.1.4 (H:) HslV (ClpQ) protease {Haemophilus influenzae [TaxId: 727]} ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp
Timeline for d1g3ih_: