Lineage for d1g3kc_ (1g3k C:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 197693Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
  4. 197694Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
  5. 197799Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 197800Protein HslV (ClpQ) protease [56258] (2 species)
  7. 197837Species Haemophilus influenzae [TaxId:727] [56260] (4 PDB entries)
  8. 197843Domain d1g3kc_: 1g3k C: [41991]

Details for d1g3kc_

PDB Entry: 1g3k (more details), 1.9 Å

PDB Description: crystal structure of the h. influenzae protease hslv at 1.9 a resolution

SCOP Domain Sequences for d1g3kc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g3kc_ d.153.1.4 (C:) HslV (ClpQ) protease {Haemophilus influenzae}
ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp

SCOP Domain Coordinates for d1g3kc_:

Click to download the PDB-style file with coordinates for d1g3kc_.
(The format of our PDB-style files is described here.)

Timeline for d1g3kc_: