Lineage for d1g3kb_ (1g3k B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36602Fold d.153: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56234] (1 superfamily)
  4. 36603Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
  5. 36677Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 36678Protein HslV (ClpQ) protease [56258] (2 species)
  7. 36695Species Haemophilus influenzae [TaxId:727] [56260] (2 PDB entries)
  8. 36697Domain d1g3kb_: 1g3k B: [41990]

Details for d1g3kb_

PDB Entry: 1g3k (more details), 1.9 Å

PDB Description: crystal structure of the h. influenzae protease hslv at 1.9 a resolution

SCOP Domain Sequences for d1g3kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g3kb_ d.153.1.4 (B:) HslV (ClpQ) protease {Haemophilus influenzae}
ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp

SCOP Domain Coordinates for d1g3kb_:

Click to download the PDB-style file with coordinates for d1g3kb_.
(The format of our PDB-style files is described here.)

Timeline for d1g3kb_: