Lineage for d1g3ka_ (1g3k A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1222614Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1222615Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1222781Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1222782Protein HslV (ClpQ) protease [56258] (4 species)
    dodecameric prokaryotic homologue of proteasome
  7. 1222836Species Haemophilus influenzae [TaxId:727] [56260] (6 PDB entries)
  8. 1222837Domain d1g3ka_: 1g3k A: [41989]
    complexed with na

Details for d1g3ka_

PDB Entry: 1g3k (more details), 1.9 Å

PDB Description: crystal structure of the h. influenzae protease hslv at 1.9 a resolution
PDB Compounds: (A:) ATP-dependent protease hslv

SCOPe Domain Sequences for d1g3ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g3ka_ d.153.1.4 (A:) HslV (ClpQ) protease {Haemophilus influenzae [TaxId: 727]}
ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp

SCOPe Domain Coordinates for d1g3ka_:

Click to download the PDB-style file with coordinates for d1g3ka_.
(The format of our PDB-style files is described here.)

Timeline for d1g3ka_: