Lineage for d1g4bp_ (1g4b P:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2548926Protein HslV (ClpQ) protease [56258] (4 species)
    dodecameric prokaryotic homologue of proteasome
  7. 2548942Species Escherichia coli [TaxId:562] [56259] (8 PDB entries)
  8. 2548989Domain d1g4bp_: 1g4b P: [41988]
    Other proteins in same PDB: d1g4be_, d1g4bf_, d1g4bk_, d1g4bl_

Details for d1g4bp_

PDB Entry: 1g4b (more details), 7 Å

PDB Description: crystal structures of the hslvu peptidase-atpase complex reveal an atp-dependent proteolysis mechanism
PDB Compounds: (P:) ATP-dependent protease hslv

SCOPe Domain Sequences for d1g4bp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g4bp_ d.153.1.4 (P:) HslV (ClpQ) protease {Escherichia coli [TaxId: 562]}
ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsy

SCOPe Domain Coordinates for d1g4bp_:

Click to download the PDB-style file with coordinates for d1g4bp_.
(The format of our PDB-style files is described here.)

Timeline for d1g4bp_: