Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (3 proteins) |
Protein HslV (ClpQ) protease [56258] (3 species) dodecameric prokaryotic homologue of proteasome |
Species Escherichia coli [TaxId:562] [56259] (7 PDB entries) |
Domain d1g4bn_: 1g4b N: [41986] Other proteins in same PDB: d1g4be_, d1g4bf_, d1g4bk_, d1g4bl_ |
PDB Entry: 1g4b (more details), 7 Å
SCOP Domain Sequences for d1g4bn_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g4bn_ d.153.1.4 (N:) HslV (ClpQ) protease {Escherichia coli} ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsy
Timeline for d1g4bn_: