SCOPe 2.08: Domain d1g4bm_: 1g4b M:

Lineage for d1g4bm_ (1g4b M:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein HslV (ClpQ) protease [56258] (4 species)
   dodecameric prokaryotic homologue of proteasome

7. Species Escherichia coli [TaxId:562] [56259] (8 PDB entries)

8. Domain d1g4bm_: 1g4b M: [41985]
   Other proteins in same PDB: d1g4be_, d1g4bf_, d1g4bk_, d1g4bl_

Details for d1g4bm_

PDB Entry: 1g4b, 7 Å

PDB Description: crystal structures of the hslvu peptidase-atpase complex reveal an atp-dependent proteolysis mechanism

PDB Compounds: (M:) ATP-dependent protease hslv

SCOPe Domain Sequences for d1g4bm_:

Sequence; same for both SEQRES and ATOM records:

>d1g4bm_ d.153.1.4 (M:) HslV (ClpQ) protease {Escherichia coli [TaxId: 562]}
ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsy

Timeline for d1g4bm_:

• d1g4bm_ first appeared (with stable ids) in SCOP 1.55
  
• d1g4bm_ appears in SCOPe 2.07