SCOP 1.73: Domain d1g4ad_: 1g4a D:

Lineage for d1g4ad_ (1g4a D:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (6 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (3 proteins)

6. Protein HslV (ClpQ) protease [56258] (3 species)
   dodecameric prokaryotic homologue of proteasome

7. Species Escherichia coli [TaxId:562] [56259] (7 PDB entries)

8. Domain d1g4ad_: 1g4a D: [41984]
   Other proteins in same PDB: d1g4ae_, d1g4af_
   complexed with dat

Details for d1g4ad_

PDB Entry: 1g4a, 3 Å

PDB Description: crystal structures of the hslvu peptidase-atpase complex reveal an atp-dependent proteolysis mechanism

PDB Compounds: (D:) ATP-dependent protease hslv

SCOP Domain Sequences for d1g4ad_:

Sequence; same for both SEQRES and ATOM records:

>d1g4ad_ d.153.1.4 (D:) HslV (ClpQ) protease {Escherichia coli [TaxId: 562]}
ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsy

Timeline for d1g4ad_:

• d1g4ad_ first appeared (with stable ids) in SCOP 1.55
  
• d1g4ad_ appears in SCOP 1.71
  
• d1g4ad_ appears in SCOP 1.75
  
• d1g4ad_ appears in the current release, SCOPe 2.08