SCOP 1.65: Domain d1e94d_: 1e94 D:

Lineage for d1e94d_ (1e94 D:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (3 proteins)

6. Protein HslV (ClpQ) protease [56258] (3 species)
   dodecameric prokaryotic homologue of proteasome

7. Species Escherichia coli [TaxId:562] [56259] (7 PDB entries)

8. Domain d1e94d_: 1e94 D: [41980]
   Other proteins in same PDB: d1e94e_, d1e94f_
   complexed with anp

Details for d1e94d_

PDB Entry: 1e94, 2.8 Å

PDB Description: hslv-hslu from e.coli

SCOP Domain Sequences for d1e94d_:

Sequence; same for both SEQRES and ATOM records:

>d1e94d_ d.153.1.4 (D:) HslV (ClpQ) protease {Escherichia coli}
ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk

Timeline for d1e94d_:

• d1e94d_ first appeared (with stable ids) in SCOP 1.55
  
• d1e94d_ appears in SCOP 1.63
  
• d1e94d_ appears in SCOP 1.67
  
• d1e94d_ appears in the current release, SCOPe 2.08