SCOPe 2.03: Domain d1nedc_: 1ned C:

Lineage for d1nedc_ (1ned C:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein HslV (ClpQ) protease [56258] (4 species)
   dodecameric prokaryotic homologue of proteasome

7. Species Escherichia coli [TaxId:562] [56259] (8 PDB entries)

8. Domain d1nedc_: 1ned C: [41976]

Details for d1nedc_

PDB Entry: 1ned, 3.8 Å

PDB Description: crystal structure of hslv (clpq) at 3.8 angstroms resolution

PDB Compounds: (C:) hslv

SCOPe Domain Sequences for d1nedc_:

Sequence; same for both SEQRES and ATOM records:

>d1nedc_ d.153.1.4 (C:) HslV (ClpQ) protease {Escherichia coli [TaxId: 562]}
ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsykaefhhh
h

Timeline for d1nedc_:

• d1nedc_ first appeared (with stable ids) in SCOP 1.55
  
• d1nedc_ appears in SCOPe 2.02
  
• d1nedc_ appears in SCOPe 2.04
  
• d1nedc_ appears in the current release, SCOPe 2.08, called d1nedc1