Lineage for d1nedc_ (1ned C:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.153: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56234] (1 superfamily) Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) 
Family d.153.1.4: Proteasome subunits [56251] (3 proteins) Protein HslV (ClpQ) protease [56258] (2 species) 
Species Escherichia coli [TaxId:562] [56259] (4 PDB entries) 
Domain d1nedc_: 1ned C: [41976]
Details for d1nedc_
PDB Entry: 1ned (more details), 3.8 Å
PDB Description: crystal structure of hslv (clpq) at 3.8 angstroms resolution
SCOP Domain Sequences for d1nedc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nedc_ d.153.1.4 (C:) HslV (ClpQ) protease {Escherichia coli}
ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsykaefhhh
h
SCOP Domain Coordinates for d1nedc_:
Click to download the PDB-style file with coordinates for d1nedc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nedc_:
- d1nedc_ appears in SCOP 1.57
- d1nedc_ appears in the current release, SCOPe 2.08, called d1nedc1
View in 3D
