Lineage for d1rype_ (1ryp E:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 84802Fold d.153: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56234] (1 superfamily)
  4. 84803Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
  5. 84882Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 84916Protein Proteasome alpha subunit (non-catalytic) [56255] (2 species)
  7. 84932Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (3 PDB entries)
  8. 84937Domain d1rype_: 1ryp E: [41936]
    Other proteins in same PDB: d1ryp1_, d1ryp2_, d1ryph_, d1rypi_, d1rypj_, d1rypk_, d1rypl_, d1rypm_, d1rypn_, d1rypv_, d1rypw_, d1rypx_, d1rypy_, d1rypz_

Details for d1rype_

PDB Entry: 1ryp (more details), 1.9 Å

PDB Description: crystal structure of the 20s proteasome from yeast at 2.4 angstroms resolution

SCOP Domain Sequences for d1rype_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rype_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae)}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

SCOP Domain Coordinates for d1rype_:

Click to download the PDB-style file with coordinates for d1rype_.
(The format of our PDB-style files is described here.)

Timeline for d1rype_: