Lineage for d1pmaj_ (1pma J:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 84802Fold d.153: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56234] (1 superfamily)
  4. 84803Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
  5. 84882Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 84916Protein Proteasome alpha subunit (non-catalytic) [56255] (2 species)
  7. 84917Species Archaeon Thermoplasma acidophilum [TaxId:2303] [56256] (1 PDB entry)
  8. 84926Domain d1pmaj_: 1pma J: [41926]
    Other proteins in same PDB: d1pma1_, d1pma2_, d1pmab_, d1pmap_, d1pmaq_, d1pmar_, d1pmas_, d1pmat_, d1pmau_, d1pmav_, d1pmaw_, d1pmax_, d1pmay_, d1pmaz_

Details for d1pmaj_

PDB Entry: 1pma (more details), 3.4 Å

PDB Description: proteasome from thermoplasma acidophilum

SCOP Domain Sequences for d1pmaj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pmaj_ d.153.1.4 (J:) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum}
tvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlidd
yvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrpy
gvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavtl
gikalkssleegeelkapeiasitvgnkyriydqeevkkfl

SCOP Domain Coordinates for d1pmaj_:

Click to download the PDB-style file with coordinates for d1pmaj_.
(The format of our PDB-style files is described here.)

Timeline for d1pmaj_: