| Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
| Fold d.153: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56234] (1 superfamily) |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) ![]() |
| Family d.153.1.4: Proteasome subunits [56251] (3 proteins) |
| Protein Proteasome beta subunit (catalytic) [56252] (2 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (3 PDB entries) |
| Domain d1g652_: 1g65 2: [41917] Other proteins in same PDB: d1g65a_, d1g65b_, d1g65c_, d1g65d_, d1g65e_, d1g65f_, d1g65g_, d1g65o_, d1g65p_, d1g65q_, d1g65r_, d1g65s_, d1g65t_, d1g65u_ |
PDB Entry: 1g65 (more details), 2.25 Å
SCOP Domain Sequences for d1g652_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g652_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae)}
tsimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivq
yhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvh
klpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvlta
agverlifypdeyeql
Timeline for d1g652_:
View in 3DDomains from other chains: (mouse over for more information) d1g651_, d1g65a_, d1g65b_, d1g65c_, d1g65d_, d1g65e_, d1g65f_, d1g65g_, d1g65h_, d1g65i_, d1g65j_, d1g65k_, d1g65l_, d1g65m_, d1g65n_, d1g65o_, d1g65p_, d1g65q_, d1g65r_, d1g65s_, d1g65t_, d1g65u_, d1g65v_, d1g65w_, d1g65x_, d1g65y_, d1g65z_ |