| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
| Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
| Protein Proteasome beta subunit (catalytic) [56252] (5 species) |
| Species Thermoplasma acidophilum [TaxId:2303] [56253] (5 PDB entries) |
| Domain d1pmax_: 1pma X: [41871] Other proteins in same PDB: d1pmaa_, d1pmac_, d1pmad_, d1pmae_, d1pmaf_, d1pmag_, d1pmah_, d1pmai_, d1pmaj_, d1pmak_, d1pmal_, d1pmam_, d1pman_, d1pmao_ |
PDB Entry: 1pma (more details), 3.4 Å
SCOPe Domain Sequences for d1pmax_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pmax_ d.153.1.4 (X:) Proteasome beta subunit (catalytic) {Thermoplasma acidophilum [TaxId: 2303]}
tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk
aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv
ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr
kdgyvqlptdqiesrirklglil
Timeline for d1pmax_:
View in 3DDomains from other chains: (mouse over for more information) d1pma1_, d1pma2_, d1pmaa_, d1pmab_, d1pmac_, d1pmad_, d1pmae_, d1pmaf_, d1pmag_, d1pmah_, d1pmai_, d1pmaj_, d1pmak_, d1pmal_, d1pmam_, d1pman_, d1pmao_, d1pmap_, d1pmaq_, d1pmar_, d1pmas_, d1pmat_, d1pmau_, d1pmav_, d1pmaw_, d1pmay_, d1pmaz_ |