SCOPe 2.08: Domain d7rjja_: 7rjj A:

Lineage for d7rjja_ (7rjj A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.7: OmpA-like [103088] (2 families)

5. Family d.79.7.0: automated matches [195454] (1 protein)
   not a true family

6. Protein automated matches [195455] (14 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:72407] [420146] (1 PDB entry)

8. Domain d7rjja_: 7rjj A: [418704]
   automated match to d5m38c_
   complexed with cl, dal

Details for d7rjja_

PDB Entry: 7rjj, 1.88 Å

PDB Description: crystal structure of the peptidoglycan binding domain of the outer membrane protein (ompa) from klebsiella pneumoniae with bound d- alanine

PDB Compounds: (A:) OmpA family protein

SCOPe Domain Sequences for d7rjja_:

Sequence; same for both SEQRES and ATOM records:

>d7rjja_ d.79.7.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 72407]}
pdvirldsmslfdtgkwvlkpgstkrlvsslmdikarpgwlivvaghtdsvgeekanqll
slkraesvrdwmrdtgdvpdscfavqgygesrpiatndtpegralnrrveislvpqvdac

Timeline for d7rjja_:

• d7rjja_ is new in SCOPe 2.08-stable