Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.7: OmpA-like [103088] (2 families) |
Family d.79.7.0: automated matches [195454] (1 protein) not a true family |
Protein automated matches [195455] (14 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:72407] [420146] (1 PDB entry) |
Domain d7rjja_: 7rjj A: [418704] automated match to d5m38c_ complexed with cl, dal |
PDB Entry: 7rjj (more details), 1.88 Å
SCOPe Domain Sequences for d7rjja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7rjja_ d.79.7.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 72407]} pdvirldsmslfdtgkwvlkpgstkrlvsslmdikarpgwlivvaghtdsvgeekanqll slkraesvrdwmrdtgdvpdscfavqgygesrpiatndtpegralnrrveislvpqvdac
Timeline for d7rjja_: