Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein Proteasome beta subunit (catalytic) [56252] (5 species) |
Species Thermoplasma acidophilum [TaxId:2303] [56253] (5 PDB entries) |
Domain d1pmav_: 1pma V: [41869] Other proteins in same PDB: d1pmaa_, d1pmac_, d1pmad_, d1pmae_, d1pmaf_, d1pmag_, d1pmah_, d1pmai_, d1pmaj_, d1pmak_, d1pmal_, d1pmam_, d1pman_, d1pmao_ |
PDB Entry: 1pma (more details), 3.4 Å
SCOPe Domain Sequences for d1pmav_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pmav_ d.153.1.4 (V:) Proteasome beta subunit (catalytic) {Thermoplasma acidophilum [TaxId: 2303]} tttvgitlkdavimaterrvtmenfimhkngkklfqidtytgmtiaglvgdaqvlvrymk aelelyrlqrrvnmpieavatllsnmlnqvkympymvqllvggidtaphvfsidaaggsv ediyastgsgspfvygvlesqysekmtvdegvdlviraisaakqrdsasggmidvavitr kdgyvqlptdqiesrirklglil
Timeline for d1pmav_:
View in 3D Domains from other chains: (mouse over for more information) d1pma1_, d1pma2_, d1pmaa_, d1pmab_, d1pmac_, d1pmad_, d1pmae_, d1pmaf_, d1pmag_, d1pmah_, d1pmai_, d1pmaj_, d1pmak_, d1pmal_, d1pmam_, d1pman_, d1pmao_, d1pmap_, d1pmaq_, d1pmar_, d1pmas_, d1pmat_, d1pmau_, d1pmaw_, d1pmax_, d1pmay_, d1pmaz_ |