Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
Protein automated matches [226905] (13 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [226582] (6 PDB entries) |
Domain d7r8vd2: 7r8v D:147-375 [418635] automated match to d1qz5a2 complexed with adp, hic, mg |
PDB Entry: 7r8v (more details), 2.82 Å
SCOPe Domain Sequences for d7r8vd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7r8vd2 c.55.1.1 (D:147-375) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrkcf
Timeline for d7r8vd2: