SCOPe 2.08: Domain d7ovgb1: 7ovg B:1-262

Lineage for d7ovgb1 (7ovg B:1-262)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.160: Carbon-nitrogen hydrolase [56316] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.160.1: Carbon-nitrogen hydrolase [56317] (3 families)
   Pfam PF00795; some topological similarities to the metallo-dependent phosphatases and DNase I-like nucleases

5. Family d.160.1.2: Carbamilase [64433] (3 proteins)

6. Protein Hypothetical protein PH0642 [103323] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [103324] (3 PDB entries)

8. Domain d7ovgb1: 7ovg B:1-262 [418593]
   Other proteins in same PDB: d7ovga2, d7ovgb2
   automated match to d1j31a_
   complexed with acm, cl

Details for d7ovgb1

PDB Entry: 7ovg, 1.65 Å

PDB Description: the c146a variant of an amidase from pyrococcus horikoshii with bound acetamide

PDB Compounds: (B:) CN hydrolase domain-containing protein

SCOPe Domain Sequences for d7ovgb1:

Sequence; same for both SEQRES and ATOM records:

>d7ovgb1 d.160.1.2 (B:1-262) Hypothetical protein PH0642 {Pyrococcus horikoshii [TaxId: 53953]}
mvkvgyiqmepkileldknyskaeklikeaskegaklvvlpelfdtgynfesreevfdva
qqipegetttflmelarelglyivagtaeksgnylynsavvvgprgyigkyrkihlfyre
kvffepgdlgfkvfdigfakvgvmiafdwffpesartlalkgaeiiahpanlvmpyapra
mpiralenrvytitadrvgeerglkfigksliaspkaevlsiaseteeeigvveidlnla
rnkrlndmndifkdrreeyyfr

Timeline for d7ovgb1:

• d7ovgb1 is new in SCOPe 2.08-stable