Lineage for d7ovga1 (7ovg A:1-262)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998496Fold d.160: Carbon-nitrogen hydrolase [56316] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2998497Superfamily d.160.1: Carbon-nitrogen hydrolase [56317] (3 families) (S)
    Pfam PF00795; some topological similarities to the metallo-dependent phosphatases and DNase I-like nucleases
  5. 2998507Family d.160.1.2: Carbamilase [64433] (3 proteins)
  6. 2998508Protein Hypothetical protein PH0642 [103323] (1 species)
  7. 2998509Species Pyrococcus horikoshii [TaxId:53953] [103324] (3 PDB entries)
  8. 2998514Domain d7ovga1: 7ovg A:1-262 [418591]
    Other proteins in same PDB: d7ovga2, d7ovgb2
    automated match to d1j31a_
    complexed with acm, cl

Details for d7ovga1

PDB Entry: 7ovg (more details), 1.65 Å

PDB Description: the c146a variant of an amidase from pyrococcus horikoshii with bound acetamide
PDB Compounds: (A:) CN hydrolase domain-containing protein

SCOPe Domain Sequences for d7ovga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ovga1 d.160.1.2 (A:1-262) Hypothetical protein PH0642 {Pyrococcus horikoshii [TaxId: 53953]}
mvkvgyiqmepkileldknyskaeklikeaskegaklvvlpelfdtgynfesreevfdva
qqipegetttflmelarelglyivagtaeksgnylynsavvvgprgyigkyrkihlfyre
kvffepgdlgfkvfdigfakvgvmiafdwffpesartlalkgaeiiahpanlvmpyapra
mpiralenrvytitadrvgeerglkfigksliaspkaevlsiaseteeeigvveidlnla
rnkrlndmndifkdrreeyyfr

SCOPe Domain Coordinates for d7ovga1:

Click to download the PDB-style file with coordinates for d7ovga1.
(The format of our PDB-style files is described here.)

Timeline for d7ovga1:

  • d7ovga1 is new in SCOPe 2.08-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d7ovga2