Lineage for d7oraf_ (7ora F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756520Domain d7oraf_: 7ora F: [418575]
    Other proteins in same PDB: d7oraa_, d7orac1, d7orac2, d7orad_, d7orar1, d7orar2
    automated match to d6shgh_
    complexed with cl, gol; mutant

Details for d7oraf_

PDB Entry: 7ora (more details), 2.6 Å

PDB Description: crystal structure of the t478k mutant receptor binding domain of sars- cov-2 spike glycoprotein in complex with covox-45 and covox-253 fabs
PDB Compounds: (F:) COVOX-253 Fab heavy chain

SCOPe Domain Sequences for d7oraf_:

Sequence, based on SEQRES records: (download)

>d7oraf_ b.1.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvqsgpevkkpgtsvkvsckasgftfttsavqwvrqargqrlewigwivvgsgntny
aqkfqervtitrdmstttaymelsslrsedtavyfcaaphcnstscydafdiwgqgtmvt
vssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

Sequence, based on observed residues (ATOM records): (download)

>d7oraf_ b.1.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvqsgpevkkpgtsvkvsckasgftfttsavqwvrqargqrlewigwivvgsgntny
aqkfqervtitrdmstttaymelsslrsedtavyfcaaphcnstscydafdiwgqgtmvt
vssastkgpsvfplapsskstgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

SCOPe Domain Coordinates for d7oraf_:

Click to download the PDB-style file with coordinates for d7oraf_.
(The format of our PDB-style files is described here.)

Timeline for d7oraf_:

  • d7oraf_ is new in SCOPe 2.08-stable