SCOPe 2.08: Domain d7ocla1: 7ocl A:4-88

Lineage for d7ocla1 (7ocl A:4-88)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)
   disulfide-rich fold; nearly all-beta

4. Superfamily g.14.1: Kringle-like [57440] (3 families)

5. Family g.14.1.1: Kringle modules [57441] (7 proteins)

6. Protein NK1 fragment of hepatocyte growth factor [57457] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57458] (20 PDB entries)

8. Domain d7ocla1: 7ocl A:4-88 [418537]
   automated match to d5cp9a2

Details for d7ocla1

PDB Entry: 7ocl, 1.8 Å

PDB Description: k1k1, a potent recombinant minimal hepatocyte growth factor/scatter factor mimic

PDB Compounds: (A:) Hepatocyte growth factor alpha chain,Hepatocyte growth factor alpha chain

SCOPe Domain Sequences for d7ocla1:

Sequence; same for both SEQRES and ATOM records:

>d7ocla1 g.14.1.1 (A:4-88) NK1 fragment of hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]}
rnciigkgrsykgtvsitksgikcqpwssmiphehsflpssyrgkdlqenycrnprgeeg
gpwcftsnpevryevcdipqcseve

Timeline for d7ocla1:

• d7ocla1 is new in SCOPe 2.08-stable