Lineage for d7mjfc_ (7mjf C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835965Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2835966Protein automated matches [190115] (94 species)
    not a true protein
  7. 2836200Species Candidatus liberibacter [TaxId:556287] [399635] (3 PDB entries)
  8. 2836209Domain d7mjfc_: 7mjf C: [418430]
    automated match to d7lvla_
    complexed with e8u, zgm

Details for d7mjfc_

PDB Entry: 7mjf (more details), 2.2 Å

PDB Description: crystal structure of candidatus liberibacter solanacearum dihydrodipicolinate synthase with pyruvate and succinic semi-aldehyde bound in active site
PDB Compounds: (C:) 4-hydroxy-tetrahydrodipicolinate synthase

SCOPe Domain Sequences for d7mjfc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7mjfc_ c.1.10.0 (C:) automated matches {Candidatus liberibacter [TaxId: 556287]}
mfqrsipalitpftkdnlidedsfvdhiewqisegssglvpagttgesstlsyeehcrvv
elcvktaagrvpvmagagsnntkesielaqyaqntgadallvvvpyynkpnkkgllahfg
sianavslpiyiynnpsrtviemdvdtmaelvktysnivgvkdatgrielasgqriacgs
dfiqlsgddssalgfnvhggvgcisvtanvapricaefqkaisegdyrqaleyqdklfpl
hqalfiepsissvkyalsrlgrnvslvvrapmvsileketmfaidqaldhiglcag

SCOPe Domain Coordinates for d7mjfc_:

Click to download the PDB-style file with coordinates for d7mjfc_.
(The format of our PDB-style files is described here.)

Timeline for d7mjfc_:

  • d7mjfc_ is new in SCOPe 2.08-stable