Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (94 species) not a true protein |
Species Candidatus liberibacter [TaxId:556287] [399635] (3 PDB entries) |
Domain d7mjfc_: 7mjf C: [418430] automated match to d7lvla_ complexed with e8u, zgm |
PDB Entry: 7mjf (more details), 2.2 Å
SCOPe Domain Sequences for d7mjfc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7mjfc_ c.1.10.0 (C:) automated matches {Candidatus liberibacter [TaxId: 556287]} mfqrsipalitpftkdnlidedsfvdhiewqisegssglvpagttgesstlsyeehcrvv elcvktaagrvpvmagagsnntkesielaqyaqntgadallvvvpyynkpnkkgllahfg sianavslpiyiynnpsrtviemdvdtmaelvktysnivgvkdatgrielasgqriacgs dfiqlsgddssalgfnvhggvgcisvtanvapricaefqkaisegdyrqaleyqdklfpl hqalfiepsissvkyalsrlgrnvslvvrapmvsileketmfaidqaldhiglcag
Timeline for d7mjfc_: