SCOPe 2.08: Domain d7mfbl1: 7mfb L:2-107

Lineage for d7mfbl1 (7mfb L:2-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d7mfbl1: 7mfb L:2-107 [418425]
   Other proteins in same PDB: d7mfbh_, d7mfbl2
   automated match to d5jo5b1

Details for d7mfbl1

PDB Entry: 7mfb, 1.74 Å

PDB Description: crystal structure of antibody 10e8v4 fab - light chain h31f variant

PDB Compounds: (L:) Antibody 10E8v4 Fab light chain

SCOPe Domain Sequences for d7mfbl1:

Sequence; same for both SEQRES and ATOM records:

>d7mfbl1 b.1.1.0 (L:2-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seltqdpavsvalkqtvtitcrgdslrsfyaswyqkkpgqapvllfygknnrpsgipdrf
sgsasgnrasltitgaqaedeadyycssrdksgsrlsvfgggtkltvl

Timeline for d7mfbl1:

• d7mfbl1 is new in SCOPe 2.08-stable