Lineage for d1ajq.1 (1ajq A:,B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36602Fold d.153: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56234] (1 superfamily)
  4. 36603Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
  5. 36646Family d.153.1.2: Penicillin acylase, catalytic domain [56244] (1 protein)
  6. 36647Protein Penicillin acylase, catalytic domain [56245] (2 species)
  7. 36648Species Escherichia coli [TaxId:562] [56246] (11 PDB entries)
  8. 36651Domain d1ajq.1: 1ajq A:,B: [41840]

Details for d1ajq.1

PDB Entry: 1ajq (more details), 2.05 Å

PDB Description: penicillin acylase complexed with thiopheneacetic acid

SCOP Domain Sequences for d1ajq.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1ajq.1 d.153.1.2 (A:,B:) Penicillin acylase, catalytic domain {Escherichia coli}
ssseikivrdeygmphiyandtwhlfygygyvvaqdrlfqmemarrstqgtvaevlgkdf
vkfdkdirrnywpdairaqiaalspedmsilqgyadgmnawidkvntnpetllpkqfntf
gftpkrwepfdvamifvgtmanrfsdstseidnlalltalkdkygvsqgmavfnqlkwlv
npsapttiavqesnyplkfnqqnsqtXsnmwvigkskaqdakaimvngpqfgwyapayty
giglhgagydvtgntpfaypglvfghngviswgstagfgddvdifaerlsaekpgyylhn
gkwvkmlsreetitvkngqaetftvwrtvhgnilqtdqttqtayaksrawdgkevaslla
wthqmkaknwqqwtqqaakqaltinwyyadvngnigyvhtgaypdrqsghdprlpvpgtg
kwdwkgllpfemnpkvynpqsgyianwnnspqkdypasdlfaflwggadrvteidrlleq
kprltadqawdvirqtsrqdlnlrlflptlqaatsgltqsdprrqlvetltrwdginlln
ddgktwqqpgsailnvwltsmlkrtvvaavpmpfdkwysasgyettqdgptgslnisvga
kilyeavqgdkspipqavdlfagkpqqevvlaaledtwetlskrygnnvsnwktpamalt
frannffgvpqaaaeetrhqaeyqnrgtendmivfspttsdrpvlawdvvapgqsgfiap
dgtvdkhyedqlkmyenfgrkslwltkqdveahkesqevlhvqr

SCOP Domain Coordinates for d1ajq.1:

Click to download the PDB-style file with coordinates for d1ajq.1.
(The format of our PDB-style files is described here.)

Timeline for d1ajq.1: