Lineage for d1ajq.1 (1ajq A:,B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988443Family d.153.1.2: Penicillin acylase, catalytic domain [56244] (3 proteins)
  6. 2988460Protein Penicillin acylase [56245] (2 species)
    also contains 2 all-alpha and a beta-barrel domains
    will be divided into domains in future release
  7. 2988461Species Escherichia coli [TaxId:562] [56246] (24 PDB entries)
  8. 2988481Domain d1ajq.1: 1ajq A:,B: [41840]
    complexed with ca, spa

Details for d1ajq.1

PDB Entry: 1ajq (more details), 2.05 Å

PDB Description: penicillin acylase complexed with thiopheneacetic acid
PDB Compounds: (A:) penicillin amidohydrolase, (B:) penicillin amidohydrolase

SCOPe Domain Sequences for d1ajq.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1ajq.1 d.153.1.2 (A:,B:) Penicillin acylase {Escherichia coli [TaxId: 562]}
ssseikivrdeygmphiyandtwhlfygygyvvaqdrlfqmemarrstqgtvaevlgkdf
vkfdkdirrnywpdairaqiaalspedmsilqgyadgmnawidkvntnpetllpkqfntf
gftpkrwepfdvamifvgtmanrfsdstseidnlalltalkdkygvsqgmavfnqlkwlv
npsapttiavqesnyplkfnqqnsqtXsnmwvigkskaqdakaimvngpqfgwyapayty
giglhgagydvtgntpfaypglvfghngviswgstagfgddvdifaerlsaekpgyylhn
gkwvkmlsreetitvkngqaetftvwrtvhgnilqtdqttqtayaksrawdgkevaslla
wthqmkaknwqqwtqqaakqaltinwyyadvngnigyvhtgaypdrqsghdprlpvpgtg
kwdwkgllpfemnpkvynpqsgyianwnnspqkdypasdlfaflwggadrvteidrlleq
kprltadqawdvirqtsrqdlnlrlflptlqaatsgltqsdprrqlvetltrwdginlln
ddgktwqqpgsailnvwltsmlkrtvvaavpmpfdkwysasgyettqdgptgslnisvga
kilyeavqgdkspipqavdlfagkpqqevvlaaledtwetlskrygnnvsnwktpamalt
frannffgvpqaaaeetrhqaeyqnrgtendmivfspttsdrpvlawdvvapgqsgfiap
dgtvdkhyedqlkmyenfgrkslwltkqdveahkesqevlhvqr

SCOPe Domain Coordinates for d1ajq.1:

Click to download the PDB-style file with coordinates for d1ajq.1.
(The format of our PDB-style files is described here.)

Timeline for d1ajq.1: