Lineage for d1ct9c2 (1ct9 C:1-192)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988341Family d.153.1.1: Class II glutamine amidotransferases [56236] (6 proteins)
    has slightly different topology than other families do
  6. 2988360Protein Asparagine synthetase B, N-terminal domain [56242] (1 species)
  7. 2988361Species Escherichia coli [TaxId:562] [56243] (1 PDB entry)
  8. 2988364Domain d1ct9c2: 1ct9 C:1-192 [41836]
    Other proteins in same PDB: d1ct9a1, d1ct9b1, d1ct9c1, d1ct9d1
    complexed with amp, cl, gln, ium

Details for d1ct9c2

PDB Entry: 1ct9 (more details), 2 Å

PDB Description: crystal structure of asparagine synthetase b from escherichia coli
PDB Compounds: (C:) asparagine synthetase b

SCOPe Domain Sequences for d1ct9c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ct9c2 d.153.1.1 (C:1-192) Asparagine synthetase B, N-terminal domain {Escherichia coli [TaxId: 562]}
asifgvfdiktdavelrkkalelsrlmrhrgpdwsgiyasdnailaherlsivdvnagaq
plynqqkthvlavngeiynhqalraeygdryqfqtgsdcevilalyqekgpeflddlqgm
fafalydsekdayligrdhlgiiplymgydehgqlyvasemkalvpvcrtikefpagsyl
wsqdgeirsyyh

SCOPe Domain Coordinates for d1ct9c2:

Click to download the PDB-style file with coordinates for d1ct9c2.
(The format of our PDB-style files is described here.)

Timeline for d1ct9c2: