Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.1: Class II glutamine amidotransferases [56236] (6 proteins) has slightly different topology than other families do |
Protein Asparagine synthetase B, N-terminal domain [56242] (1 species) |
Species Escherichia coli [TaxId:562] [56243] (1 PDB entry) |
Domain d1ct9c2: 1ct9 C:1-192 [41836] Other proteins in same PDB: d1ct9a1, d1ct9b1, d1ct9c1, d1ct9d1 complexed with amp, cl, gln, ium |
PDB Entry: 1ct9 (more details), 2 Å
SCOPe Domain Sequences for d1ct9c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ct9c2 d.153.1.1 (C:1-192) Asparagine synthetase B, N-terminal domain {Escherichia coli [TaxId: 562]} asifgvfdiktdavelrkkalelsrlmrhrgpdwsgiyasdnailaherlsivdvnagaq plynqqkthvlavngeiynhqalraeygdryqfqtgsdcevilalyqekgpeflddlqgm fafalydsekdayligrdhlgiiplymgydehgqlyvasemkalvpvcrtikefpagsyl wsqdgeirsyyh
Timeline for d1ct9c2: