SCOPe 2.08: Domain d7m2nd1: 7m2n D:1-159

Lineage for d7m2nd1 (7m2n D:1-159)

Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similar

Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
Protein Lactate dehydrogenase [51859] (19 species)
Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [63940] (39 PDB entries)
Domain d7m2nd1: 7m2n D:1-159 [418357]
Other proteins in same PDB: d7m2na2, d7m2nb2, d7m2nb3, d7m2nc2, d7m2nd2
automated match to d4jnka1
complexed with edo, gol, nai, peg, so4, yoj

Details for d7m2nd1

PDB Entry: 7m2n (more details), 2.5 Å

PDB Description: crystal structure of human lactate dehydrogenase a with inhibitor compound 15

PDB Compounds: (D:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d7m2nd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7m2nd1 c.2.1.5 (D:1-159) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkyspnckllivsnpvdiltyvawkisgfpknrvig

SCOPe Domain Coordinates for d7m2nd1:

Click to download the PDB-style file with coordinates for d7m2nd1.
(The format of our PDB-style files is described here.)

Timeline for d7m2nd1: