SCOPe 2.02: Domain d1ct9b2: 1ct9 B:1-192

Lineage for d1ct9b2 (1ct9 B:1-192)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.1: Class II glutamine amidotransferases [56236] (6 proteins)
   has slightly different topology than other families do

6. Protein Asparagine synthetase B, N-terminal domain [56242] (1 species)

7. Species Escherichia coli [TaxId:562] [56243] (1 PDB entry)

8. Domain d1ct9b2: 1ct9 B:1-192 [41835]
   Other proteins in same PDB: d1ct9a1, d1ct9b1, d1ct9c1, d1ct9d1
   complexed with amp, cl, gln, ium

Details for d1ct9b2

PDB Entry: 1ct9, 2 Å

PDB Description: crystal structure of asparagine synthetase b from escherichia coli

PDB Compounds: (B:) asparagine synthetase b

SCOPe Domain Sequences for d1ct9b2:

Sequence; same for both SEQRES and ATOM records:

>d1ct9b2 d.153.1.1 (B:1-192) Asparagine synthetase B, N-terminal domain {Escherichia coli [TaxId: 562]}
asifgvfdiktdavelrkkalelsrlmrhrgpdwsgiyasdnailaherlsivdvnagaq
plynqqkthvlavngeiynhqalraeygdryqfqtgsdcevilalyqekgpeflddlqgm
fafalydsekdayligrdhlgiiplymgydehgqlyvasemkalvpvcrtikefpagsyl
wsqdgeirsyyh

Timeline for d1ct9b2:

• d1ct9b2 first appeared (with stable ids) in SCOP 1.55
  
• d1ct9b2 appears in SCOPe 2.01
  
• d1ct9b2 appears in SCOPe 2.03
  
• d1ct9b2 appears in the current release, SCOPe 2.08