SCOP 1.59: Domain d1ct9b2: 1ct9 B:1-192

Lineage for d1ct9b2 (1ct9 B:1-192)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.153: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56234] (1 superfamily)

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families)

5. Family d.153.1.1: Class II glutamine amidotransferases [56236] (5 proteins)

6. Protein Asparagine synthetase B, N-terminal domain [56242] (1 species)

7. Species Escherichia coli [TaxId:562] [56243] (1 PDB entry)

8. Domain d1ct9b2: 1ct9 B:1-192 [41835]
   Other proteins in same PDB: d1ct9a1, d1ct9b1, d1ct9c1, d1ct9d1

Details for d1ct9b2

PDB Entry: 1ct9, 2 Å

PDB Description: crystal structure of asparagine synthetase b from escherichia coli

SCOP Domain Sequences for d1ct9b2:

Sequence; same for both SEQRES and ATOM records:

>d1ct9b2 d.153.1.1 (B:1-192) Asparagine synthetase B, N-terminal domain {Escherichia coli}
asifgvfdiktdavelrkkalelsrlmrhrgpdwsgiyasdnailaherlsivdvnagaq
plynqqkthvlavngeiynhqalraeygdryqfqtgsdcevilalyqekgpeflddlqgm
fafalydsekdayligrdhlgiiplymgydehgqlyvasemkalvpvcrtikefpagsyl
wsqdgeirsyyh

Timeline for d1ct9b2:

• d1ct9b2 first appeared (with stable ids) in SCOP 1.55
  
• d1ct9b2 appears in SCOP 1.57
  
• d1ct9b2 appears in SCOP 1.61
  
• d1ct9b2 appears in the current release, SCOPe 2.08