Lineage for d1ct9b2 (1ct9 B:1-192)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36602Fold d.153: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56234] (1 superfamily)
  4. 36603Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
  5. 36604Family d.153.1.1: Class II glutamine amidotransferases [56236] (3 proteins)
  6. 36605Protein Asparagine synthetase B, N-terminal domain [56242] (1 species)
  7. 36606Species Escherichia coli [TaxId:562] [56243] (1 PDB entry)
  8. 36608Domain d1ct9b2: 1ct9 B:1-192 [41835]
    Other proteins in same PDB: d1ct9a1, d1ct9b1, d1ct9c1, d1ct9d1

Details for d1ct9b2

PDB Entry: 1ct9 (more details), 2 Å

PDB Description: crystal structure of asparagine synthetase b from escherichia coli

SCOP Domain Sequences for d1ct9b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ct9b2 d.153.1.1 (B:1-192) Asparagine synthetase B, N-terminal domain {Escherichia coli}
asifgvfdiktdavelrkkalelsrlmrhrgpdwsgiyasdnailaherlsivdvnagaq
plynqqkthvlavngeiynhqalraeygdryqfqtgsdcevilalyqekgpeflddlqgm
fafalydsekdayligrdhlgiiplymgydehgqlyvasemkalvpvcrtikefpagsyl
wsqdgeirsyyh

SCOP Domain Coordinates for d1ct9b2:

Click to download the PDB-style file with coordinates for d1ct9b2.
(The format of our PDB-style files is described here.)

Timeline for d1ct9b2: