SCOPe 2.08: Domain d7lyac1: 7lya C:12-119

Lineage for d7lyac1 (7lya C:12-119)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein automated matches [193445] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193446] (79 PDB entries)

8. Domain d7lyac1: 7lya C:12-119 [418344]
   Other proteins in same PDB: d7lyaa_, d7lyac2, d7lyae_, d7lyag2
   automated match to d5f99g_
   protein/DNA complex

Details for d7lyac1

PDB Entry: 7lya, 2.91 Å

PDB Description: cryo-em structure of the human nucleosome core particle with linked histone proteins h2a and h2b

PDB Compounds: (C:) Histone H2A type 1-B/E

SCOPe Domain Sequences for d7lyac1:

Sequence; same for both SEQRES and ATOM records:

>d7lyac1 a.22.1.1 (C:12-119) automated matches {Human (Homo sapiens) [TaxId: 9606]}
akaktrssraglqfpvgrvhrllrkgnyservgagapvylaavleyltaeilelagnaar
dnkktriiprhlqlairndeelnkllgrvtiaqggvlpniqavllpkk

Timeline for d7lyac1:

• d7lyac1 is new in SCOPe 2.08-stable