Lineage for d1ct9a2 (1ct9 A:1-192)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1437613Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1437614Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1437615Family d.153.1.1: Class II glutamine amidotransferases [56236] (6 proteins)
    has slightly different topology than other families do
  6. 1437634Protein Asparagine synthetase B, N-terminal domain [56242] (1 species)
  7. 1437635Species Escherichia coli [TaxId:562] [56243] (1 PDB entry)
  8. 1437636Domain d1ct9a2: 1ct9 A:1-192 [41834]
    Other proteins in same PDB: d1ct9a1, d1ct9b1, d1ct9c1, d1ct9d1
    complexed with amp, cl, gln, ium

Details for d1ct9a2

PDB Entry: 1ct9 (more details), 2 Å

PDB Description: crystal structure of asparagine synthetase b from escherichia coli
PDB Compounds: (A:) asparagine synthetase b

SCOPe Domain Sequences for d1ct9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ct9a2 d.153.1.1 (A:1-192) Asparagine synthetase B, N-terminal domain {Escherichia coli [TaxId: 562]}
asifgvfdiktdavelrkkalelsrlmrhrgpdwsgiyasdnailaherlsivdvnagaq
plynqqkthvlavngeiynhqalraeygdryqfqtgsdcevilalyqekgpeflddlqgm
fafalydsekdayligrdhlgiiplymgydehgqlyvasemkalvpvcrtikefpagsyl
wsqdgeirsyyh

SCOPe Domain Coordinates for d1ct9a2:

Click to download the PDB-style file with coordinates for d1ct9a2.
(The format of our PDB-style files is described here.)

Timeline for d1ct9a2: