![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.1: Class II glutamine amidotransferases [56236] (5 proteins) has slightly different topology than other families do |
![]() | Protein Asparagine synthetase B, N-terminal domain [56242] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [56243] (1 PDB entry) |
![]() | Domain d1ct9a2: 1ct9 A:1-192 [41834] Other proteins in same PDB: d1ct9a1, d1ct9b1, d1ct9c1, d1ct9d1 |
PDB Entry: 1ct9 (more details), 2 Å
SCOP Domain Sequences for d1ct9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ct9a2 d.153.1.1 (A:1-192) Asparagine synthetase B, N-terminal domain {Escherichia coli} asifgvfdiktdavelrkkalelsrlmrhrgpdwsgiyasdnailaherlsivdvnagaq plynqqkthvlavngeiynhqalraeygdryqfqtgsdcevilalyqekgpeflddlqgm fafalydsekdayligrdhlgiiplymgydehgqlyvasemkalvpvcrtikefpagsyl wsqdgeirsyyh
Timeline for d1ct9a2: