Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.31: Photosystem I reaction center subunit XI, PsaL [81569] (1 superfamily) core: three transmembrane helices, bundle |
Superfamily f.31.1: Photosystem I reaction center subunit XI, PsaL [81568] (2 families) automatically mapped to Pfam PF02605 |
Family f.31.1.0: automated matches [375525] (1 protein) not a true family |
Protein automated matches [375526] (6 species) not a true protein |
Species Fischerella thermalis [TaxId:98439] [420133] (1 PDB entry) |
Domain d7lx0l_: 7lx0 L: [418337] Other proteins in same PDB: d7lx0b_, d7lx0c_, d7lx0e_, d7lx0h_, d7lx0m_, d7lx0n_, d7lx0p_, d7lx0v_ automated match to d5oy0l_ complexed with bcr, ca, cl0, cla, f6c, lhg, lmg, lmt, pqn, sf4 |
PDB Entry: 7lx0 (more details), 2.96 Å
SCOPe Domain Sequences for d7lx0l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7lx0l_ f.31.1.0 (L:) automated matches {Fischerella thermalis [TaxId: 98439]} ndiikpfkgdpclgnlstpindsplakafinnlpayrkgltpfmrgleigmahgyflvgp evvigplresahganlsglitaiyiavsaclgisifaittfqgnpkgsyssyskdslrpl rtreewsqlnggiflgamggaifaylllenfdaldailrgavn
Timeline for d7lx0l_: