Lineage for d7lx0l_ (7lx0 L:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027932Fold f.31: Photosystem I reaction center subunit XI, PsaL [81569] (1 superfamily)
    core: three transmembrane helices, bundle
  4. 3027933Superfamily f.31.1: Photosystem I reaction center subunit XI, PsaL [81568] (2 families) (S)
    automatically mapped to Pfam PF02605
  5. 3027955Family f.31.1.0: automated matches [375525] (1 protein)
    not a true family
  6. 3027956Protein automated matches [375526] (6 species)
    not a true protein
  7. 3027962Species Fischerella thermalis [TaxId:98439] [420133] (1 PDB entry)
  8. 3027963Domain d7lx0l_: 7lx0 L: [418337]
    Other proteins in same PDB: d7lx0b_, d7lx0c_, d7lx0e_, d7lx0h_, d7lx0m_, d7lx0n_, d7lx0p_, d7lx0v_
    automated match to d5oy0l_
    complexed with bcr, ca, cl0, cla, f6c, lhg, lmg, lmt, pqn, sf4

Details for d7lx0l_

PDB Entry: 7lx0 (more details), 2.96 Å

PDB Description: quantitative assessment of chlorophyll types in cryo-em maps of photosystem i acclimated to far-red light
PDB Compounds: (L:) PSI subunit V

SCOPe Domain Sequences for d7lx0l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7lx0l_ f.31.1.0 (L:) automated matches {Fischerella thermalis [TaxId: 98439]}
ndiikpfkgdpclgnlstpindsplakafinnlpayrkgltpfmrgleigmahgyflvgp
evvigplresahganlsglitaiyiavsaclgisifaittfqgnpkgsyssyskdslrpl
rtreewsqlnggiflgamggaifaylllenfdaldailrgavn

SCOPe Domain Coordinates for d7lx0l_:

Click to download the PDB-style file with coordinates for d7lx0l_.
(The format of our PDB-style files is described here.)

Timeline for d7lx0l_:

  • d7lx0l_ is new in SCOPe 2.08-stable