Lineage for d7lvsb_ (7lvs B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038292Fold g.53: TAZ domain [57932] (1 superfamily)
    all-alpha fold; Zn-binding sites are in the loops connecting helices
  4. 3038293Superfamily g.53.1: TAZ domain [57933] (1 family) (S)
    automatically mapped to Pfam PF02135
  5. 3038294Family g.53.1.1: TAZ domain [57934] (2 proteins)
  6. 3038295Protein CREB-binding transcriptional adaptor protein CBP (p300) [57935] (2 species)
  7. 3038300Species Mouse (Mus musculus) [TaxId:10090] [57936] (7 PDB entries)
  8. 3038301Domain d7lvsb_: 7lvs B: [418332]
    automated match to d2lwwa_
    complexed with zn

Details for d7lvsb_

PDB Entry: 7lvs (more details), 2.02 Å

PDB Description: the cbp taz1 domain in complex with a cited2-hif-1-alpha fusion peptide
PDB Compounds: (B:) Histone lysine acetyltransferase CREBBP

SCOPe Domain Sequences for d7lvsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7lvsb_ g.53.1.1 (B:) CREB-binding transcriptional adaptor protein CBP (p300) {Mouse (Mus musculus) [TaxId: 10090]}
tgptadpekrkliqqqlvlllhahkcqrreqangevracslphcrtmknvlnhmthcqag
kacqvahcassrqiishwknctrhdcpvclplknasd

SCOPe Domain Coordinates for d7lvsb_:

Click to download the PDB-style file with coordinates for d7lvsb_.
(The format of our PDB-style files is described here.)

Timeline for d7lvsb_:

  • d7lvsb_ is new in SCOPe 2.08-stable