Lineage for d1ecjd2 (1ecj D:1-249)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36602Fold d.153: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56234] (1 superfamily)
  4. 36603Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
  5. 36604Family d.153.1.1: Class II glutamine amidotransferases [56236] (3 proteins)
  6. 36621Protein Glutamine PRPP amidotransferase, N-terminal domain [56239] (2 species)
  7. 36631Species Escherichia coli [TaxId:562] [56241] (5 PDB entries)
  8. 36641Domain d1ecjd2: 1ecj D:1-249 [41829]
    Other proteins in same PDB: d1ecja1, d1ecjb1, d1ecjc1, d1ecjd1

Details for d1ecjd2

PDB Entry: 1ecj (more details), 2.5 Å

PDB Description: escherichia coli glutamine phosphoribosylpyrophosphate (prpp) amidotransferase complexed with 2 amp per tetramer

SCOP Domain Sequences for d1ecjd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ecjd2 d.153.1.1 (D:1-249) Glutamine PRPP amidotransferase, N-terminal domain {Escherichia coli}
cgivgiagvmpvnqsiydaltvlqhrgqdaagiitidanncfrlrkanglvsdvfearhm
qrlqgnmgighvryptagsssaseaqpfyvnspygitlahngnltnahelrkklfeekrr
hinttsdseillnifaseldnfrhypleadnifaaiaatnrlirgayacvamiighgmva
frdpngirplvlgkrdidenrteymvasesvaldtlgfdflrdvapgeaiyiteegqlft
rqcadnpvs

SCOP Domain Coordinates for d1ecjd2:

Click to download the PDB-style file with coordinates for d1ecjd2.
(The format of our PDB-style files is described here.)

Timeline for d1ecjd2: