Lineage for d1ecjb2 (1ecj B:1-249)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.153: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56234] (1 superfamily) Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) 
Family d.153.1.1: Class II glutamine amidotransferases [56236] (3 proteins) 
Protein Glutamine PRPP amidotransferase, N-terminal domain [56239] (2 species) Species Escherichia coli [TaxId:562] [56241] (5 PDB entries) 
Domain d1ecjb2: 1ecj B:1-249 [41827]
Other proteins in same PDB: d1ecja1, d1ecjb1, d1ecjc1, d1ecjd1
Details for d1ecjb2
PDB Entry: 1ecj (more details), 2.5 Å
PDB Description: escherichia coli glutamine phosphoribosylpyrophosphate (prpp) amidotransferase complexed with 2 amp per tetramer
SCOP Domain Sequences for d1ecjb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ecjb2 d.153.1.1 (B:1-249) Glutamine PRPP amidotransferase, N-terminal domain {Escherichia coli}
cgivgiagvmpvnqsiydaltvlqhrgqdaagiitidanncfrlrkanglvsdvfearhm
qrlqgnmgighvryptagsssaseaqpfyvnspygitlahngnltnahelrkklfeekrr
hinttsdseillnifaseldnfrhypleadnifaaiaatnrlirgayacvamiighgmva
frdpngirplvlgkrdidenrteymvasesvaldtlgfdflrdvapgeaiyiteegqlft
rqcadnpvs
SCOP Domain Coordinates for d1ecjb2:
Click to download the PDB-style file with coordinates for d1ecjb2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ecjb2:
View in 3D
