Lineage for d1ecca2 (1ecc A:1-249)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988341Family d.153.1.1: Class II glutamine amidotransferases [56236] (6 proteins)
    has slightly different topology than other families do
  6. 2988409Protein Glutamine PRPP amidotransferase, N-terminal domain [56239] (3 species)
  7. 2988419Species Escherichia coli [TaxId:562] [56241] (5 PDB entries)
  8. 2988424Domain d1ecca2: 1ecc A:1-249 [41824]
    Other proteins in same PDB: d1ecca1, d1eccb1
    complexed with mn, onl, pcp

Details for d1ecca2

PDB Entry: 1ecc (more details), 2.4 Å

PDB Description: escherichia coli glutamine phosphoribosylpyrophosphate (prpp) amidotransferase complexed with mn-cprpp and 5-oxo-norleucine
PDB Compounds: (A:) glutamine phosphoribosylpyrophosphate amidotransferase

SCOPe Domain Sequences for d1ecca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ecca2 d.153.1.1 (A:1-249) Glutamine PRPP amidotransferase, N-terminal domain {Escherichia coli [TaxId: 562]}
cgivgiagvmpvnqsiydaltvlqhrgqdaagiitidanncfrlrkanglvsdvfearhm
qrlqgnmgighvryptagsssaseaqpfyvnspygitlahngnltnahelrkklfeekrr
hinttsdseillnifaseldnfrhypleadnifaaiaatnrlirgayacvamiighgmva
frdpngirplvlgkrdidenrteymvasesvaldtlgfdflrdvapgeaiyiteegqlft
rqcadnpvs

SCOPe Domain Coordinates for d1ecca2:

Click to download the PDB-style file with coordinates for d1ecca2.
(The format of our PDB-style files is described here.)

Timeline for d1ecca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ecca1