Lineage for d1ecgb2 (1ecg B:1-249)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 36602Fold d.153: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56234] (1 superfamily)
  4. 36603Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
  5. 36604Family d.153.1.1: Class II glutamine amidotransferases [56236] (3 proteins)
  6. 36621Protein Glutamine PRPP amidotransferase, N-terminal domain [56239] (2 species)
  7. 36631Species Escherichia coli [TaxId:562] [56241] (5 PDB entries)
  8. 36635Domain d1ecgb2: 1ecg B:1-249 [41823]
    Other proteins in same PDB: d1ecga1, d1ecgb1

Details for d1ecgb2

PDB Entry: 1ecg (more details), 2.3 Å

PDB Description: don inactivated escherichia coli glutamine phosphoribosylpyrophosphate (prpp) amidotransferase

SCOP Domain Sequences for d1ecgb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ecgb2 d.153.1.1 (B:1-249) Glutamine PRPP amidotransferase, N-terminal domain {Escherichia coli}
cgivgiagvmpvnqsiydaltvlqhrgqdaagiitidanncfrlrkanglvsdvfearhm
qrlqgnmgighvryptagsssaseaqpfyvnspygitlahngnltnahelrkklfeekrr
hinttsdseillnifaseldnfrhypleadnifaaiaatnrlirgayacvamiighgmva
frdpngirplvlgkrdidenrteymvasesvaldtlgfdflrdvapgeaiyiteegqlft
rqcadnpvs

SCOP Domain Coordinates for d1ecgb2:

Click to download the PDB-style file with coordinates for d1ecgb2.
(The format of our PDB-style files is described here.)

Timeline for d1ecgb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ecgb1